DPCstruct | MC11721
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 199 ± 47 aa |
| Standard deviation of domain lengths | 47.40 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2RZE3 | 705-909 | NAYPLYYYDDLGNRHYAISGYALNLFRKHYEDNSIAEEEIFYYIYAILHHKGYLEKYKNSLTKEEPRIALSEDFKELSVLGKELAKL… |
| X0ZK61 | 84-310 | KENLALLTCRQQSTFDFQHVFLTKILVDICTVSMQTKETGYAFPLFLYFKDGSRATNLNMEIVAEIEKIAGKVSPEDIFDYIYAVLH… |
| A0A2T1DN43 | 177-416 | None |
| A0A7V9JIQ5 | 5-159 | None |
| A0A2V9BT34 | 168-441 | None |
| A0A496FHC9 | 17-198 | None |
| A0A432QVU0 | 15-187 | None |
| A0A6L7YH28 | 2-186 | None |
| A0A821A9P2 | 362-496 | None |
| D7N3Y8 | 181-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.