DPCstruct | MC11720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V2V2U5 | 1-87 | MNRILNVKLENCFGIGKLEKEFKFTPKERAQLIYAPNGTMKSSFANVFEYLSKDQNSEIKDRIFSEKVPICDIKFNSQNLNKDMILV |
| A0A1Q2RVX7 | 1-66 | MELKIINMENCYGIGKMKEILNFSQANSYLLYAQNGVFKTSFAKSLTDLINSEMPKDNFYPNRESK |
| A0A483A4Z9 | 1-71 | None |
| M4ZRG3 | 1-77 | None |
| A0A3N6A807 | 1-78 | None |
| O26049 | 1-77 | None |
| A0A7U5X721 | 1-70 | None |
| A0A6N6C186 | 2-76 | None |
| A0A7Z7RIV5 | 1-77 | None |
| A0A828T4A8 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.