DPCstruct | MC11718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 4 aa |
| Standard deviation of domain lengths | 3.66 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q2RBT9 | 1-79 | MSAEKTKELADLFVSKRTFLAGNWAMQRAQHGEQPDWALIVLASMIGQVGLSGGGFGFSMHYGGNAQASSGARIVPMIS |
| E8KKF7 | 1-77 | MLAGKRTQLIFGWAIQRQQHGEQPYWMGAVLAAMLGQIGLAGGGISYAHHYSSIGVSSSGAAMPSSFPSNLDEGQTV |
| A0A2V2L2P6 | 3-79 | None |
| A0A8B4CTQ8 | 2-76 | None |
| A0A376TZ02 | 20-102 | None |
| A0A376RLX4 | 3-76 | None |
| A0A2X3E3M0 | 2-78 | None |
| A0A448QQR0 | 15-94 | None |
| A0A3S4GH34 | 33-104 | None |
| A0A2X1MWA8 | 32-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.