DPCstruct | MC11715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 265 ± 20 aa |
| Standard deviation of domain lengths | 19.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090CYK0 | 935-1187 | GSPTMQGTISYAEVTPEFLSYLEELQAAQKNHFFILNQNMIANYRFVGEVETDRIQALLDIANQKYKDTLYLFLSSMNSPFYYQGHE… |
| A0A433K1M0 | 1-272 | MSNLGHTEYRFSTQAQRHQGEVRVSPLFKRWLAISAKRTPATQLINHIYFNNLGLDRDQFDLPGANEKELTRALHQLEGESTLKTVV… |
| A0A317JE13 | 327-587 | None |
| A0A0U5ESW8 | 190-474 | None |
| A0A1M3CQZ3 | 168-422 | None |
| A0A2S9XU25 | 69-311 | None |
| A0A2E3UUZ3 | 255-524 | None |
| A0A0W0TDW2 | 229-536 | None |
| A0A0C1JRE7 | 8-260 | None |
| A0A0W0X592 | 188-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.