DPCstruct | MC11714
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 179 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9YLZ8 | 164-345 | QRLIEKGLISREEVLEMTDSAYKPHLKLIDYALSDNEISISTHAGVGLKNIRFVANKLGIAYDDTSANALAETIDRINQKFSNDYVM… |
| A0A433JXG4 | 1-209 | MLSRGGHAPSLEKLQEIIERGLVSREEVIQLANRAYKPSLKAISYSLNEDQTNITLYSHAAVGINTIKLVAEKLGLPYADGTALQLA… |
| G9ELX3 | 325-491 | None |
| A0A222P0C8 | 510-680 | None |
| A0A433JKB9 | 208-369 | None |
| A0A1Q4EE59 | 47-225 | None |
| A0A0W0VKN1 | 170-343 | None |
| A0A078KVK6 | 159-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.