DPCstruct | MC11713
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 222 ± 29 aa |
| Standard deviation of domain lengths | 28.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810KWD2 | 20-247 | LDAIAAEAVTAYRETLAVDGFAAELFTAELLGGWWQGAVAAGTNPEAVPRALVRYAAHRRTEEALAALLALAHLGTSAALRDAARAA… |
| A0A4R5FPM7 | 2-219 | AEIWATSWLGQAWVTAELSEREAEHRLCMEVTGRACTTPSPHGLAAIAAPARVALATDITMLAETIDILAETQPLPPGPPPCPRTAA… |
| A0A3E0I8W7 | 32-250 | None |
| A0A0Q9M614 | 32-297 | None |
| A0A0X8X7A5 | 54-348 | None |
| A0A4Q7J5U8 | 15-248 | None |
| A0A511CX40 | 29-248 | None |
| A0A1R4HZ44 | 10-189 | None |
| A0A7G8PLP3 | 43-248 | None |
| A0A2W4Z156 | 5-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.