DPCstruct | MC1171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 51.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1CVX4 | 1-67 | MTIYAYKIDPRDPDLGGGYRLRLWADDEEVGGGVFPATPGNRDEDHTAHALALAEGDDWLASRGDRD |
| A0A7Z0LB83 | 92-149 | PKRSYEITPRPPELGGGFRLRLIEDGEEVGGGVFPLDASAGDVEQAFEEARAEALGWM |
| A0A015NBW8 | 2-66 | None |
| A0A7H4LRR5 | 60-129 | None |
| A0A0H5Q547 | 2-69 | None |
| A0A383SH58 | 1-69 | None |
| A0A7I6Q2L8 | 138-204 | None |
| A0A6M4DUU1 | 99-168 | None |
| A0A259Q5G3 | 1-72 | None |
| A0A5T3SM43 | 6-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.