DPCstruct | MC11707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 57.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C7J192 | 1-78 | MVLLGDLVLSNKLVVYDLENQVIGWTEYNCSSSIKIKDEQTGATYTVDAHNISSGWRFHWQKHLAVLLVTMVYSYLIF |
| A0A446YPV4 | 1-99 | MQELYCMGFQTGGLQTKDGKDMVLLGDLAFSNRLVLYDLENQVIGWTDYNCSSSIKIKDDKTGSIYTVNAHDISSGWRFQWHKSLFV… |
| A0A498IKB1 | 453-535 | None |
| A0A0E0GZ89 | 102-198 | None |
| A0A835UD37 | 11-112 | None |
| A0A287I9S1 | 49-153 | None |
| A0A0D9VFY0 | 390-485 | None |
| A0A0D3AFZ2 | 679-777 | None |
| M1APH3 | 42-135 | None |
| A0A7G2DQ94 | 706-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.