DPCstruct | MC11706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 22.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.03 |
| Pfam Score | 99.35 |
| Assigned Pfam label(s) | CL0261- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7FYW6 | 2-137 | LLEHTTDIYDGVTVDGASLPATTEEFKSVLEASLEAWRSTGKKGVWLKVPADRTELVPVSIDLGFELHHAEKAYIMLNMWLPSTASQ… |
| A0A446YPI7 | 16-156 | MTKNGGDVELLPFVYDKHGGIIIEMTSPMDPQAFSASLKSLLSKWREQGIRGVWIKLPISLANLIQSAVEEGFWYHHAEETYLMLAY… |
| A0A834WW98 | 289-453 | None |
| A0A453SIH4 | 24-183 | None |
| A0A067KNC4 | 60-175 | None |
| A0A158QYM5 | 3-138 | None |
| A0A0D3DM40 | 2-124 | None |
| A0A5A9NKM7 | 32-174 | None |
| A0A6P8HLI4 | 6-173 | None |
| A0A1B0AE84 | 74-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.