DPCstruct | MC11705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 193 ± 20 aa |
| Standard deviation of domain lengths | 19.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 63.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02416 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1AN16 | 42-232 | IPYSGLSSWNGLKQLSISKSQFSVQIGRSRKNKGKGVYASLFGVGAPEALVIGVVALLVFGPKGLAEVARNLGKTLREFQPTIRELQ… |
| A0A446YKJ6 | 1-211 | MISSCFVSCRHVCSVSIWGSNRFVVKRRRRRNGISASLFGVGAPEALVIGVVALLVFGPKGLAEAARSLGKTLRAFQPTIRELQDVS… |
| A0A058ZYE8 | 1-193 | None |
| A0A061G1L3 | 34-263 | None |
| A0A1U7ZTA2 | 37-203 | None |
| A0A6P5MQG2 | 28-185 | None |
| Q016Q7 | 18-198 | None |
| A0A7C9D7L3 | 54-252 | None |
| A0A5J4XPY1 | 1-195 | None |
| W1NID4 | 1-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.