DPCstruct | MC11702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 258 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 45.04 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF09328- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1ANJ2 | 1-230 | MDDLPVLLSSENVKDIKDVLSTLLSNLPPNFAEFIKWVAEVRRQEENGQKLSEEEKGRLAIKEEVLKQVQDTPLYKHVTSLLLSEDS… |
| A0A446Y829 | 1-231 | MAKYCVEDVPNLLKDESLDNVTTLLSRLVESLPANAGDLIKCVIEVRRKEEGESSLSKEEKERLFLKEKVLQQIRDTDLFRVVHELQ… |
| A0A7N0TBM6 | 54-341 | None |
| A0A2U1NG81 | 236-525 | None |
| A0A2I0KVN1 | 30-309 | None |
| A0A453J7N8 | 27-238 | None |
| A0A498JT65 | 228-483 | None |
| A0A438KDF2 | 52-321 | None |
| A0A2I0VC81 | 13-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.