DPCstruct | MC1170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2ULN0 | 18-112 | GRTNEDRVEVALSTLQEEGQIVDYIRSEPHGELDKRGIDFLVYPESDWLIPLQVKSSVASAEDHRAKYGPNIPCIIVFDNDTETELK… |
| A0A1J4WLC7 | 19-133 | KTKSRILNILKKCADSRGQFSARYIGMALESLKTEGKIVSYYLTDKWSRQDKQQIDAVVFRLDGTKTTLQIKSDRTMAERFKKECGN… |
| A0A7T9BF01 | 99-207 | None |
| A0A3R6ZHE0 | 23-158 | None |
| A0A1F6WNN6 | 154-265 | None |
| A0A7T5USE6 | 52-149 | None |
| A0A1F8EA16 | 30-149 | None |
| A0A1G2MFL2 | 10-113 | None |
| A0A1G2PLE3 | 2-128 | None |
| A0A2G9YXB4 | 10-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.