DPCstruct | MC11699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 67.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9SYT3 | 1-62 | MRARVSYEEYVVAVALTLARRHRPVWSWRRWRRICRCGAELPCRVRHRIPIRRGHWPGEEQT |
| A0A1C5J4E3 | 25-92 | VNDEGDSVPRVSYEEYLVAVALTFARRHQPVWSWRKWRRICRCGADLPCHARHRIPINRGHWPGEEAQ |
| A0A1C5ALC4 | 2-57 | None |
| A0A136PQX7 | 1-56 | None |
| A0A837TQY8 | 11-79 | None |
| A0A3L7BDS5 | 1-60 | None |
| A0A418MY87 | 1-68 | None |
| A0A3N1A1Z5 | 2-59 | None |
| A0A1C4W259 | 50-118 | None |
| A0A1C4WGA5 | 2-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.