DPCstruct | MC11698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 250 ± 33 aa |
| Standard deviation of domain lengths | 33.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356ESX1 | 92-372 | HESLRGATRLRVRAEGTCCNEPDKEETLLDVRDAQEVAKVVQGIRIDPDESGFHCLCCGDPTLEFYRNDTRIASLSFHHGRSLRWPD… |
| A0A1C5HTZ4 | 3-258 | LIDWLSEAWTRARAVRVLDGGLDGGPLAERTVLAETHDPVRLARMRQLTTVGRFTGDVCRCLGGPTLALYDADDTLLGSATLHGHGS… |
| A0A540P5B9 | 3-246 | None |
| A0A4P2PUA4 | 15-245 | None |
| A0A7C5N657 | 13-270 | None |
| A0A2T6CQR6 | 60-372 | None |
| A0A4V0XP97 | 352-620 | None |
| A0A1V6CMB4 | 273-513 | None |
| A0A2L0EYW2 | 23-291 | None |
| A0A0L0EWC7 | 5-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.