DPCstruct | MC11695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 141 ± 28 aa |
| Standard deviation of domain lengths | 28.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U2Q4K8 | 8-131 | DPAKWQHAVRRRLCGVCGGPLGVRMAFVGGPLSIRNRLFNDLPMHRDCATYAMRACPFLAAPRFAFARKLPEHAHVNESVSTDRPER… |
| A0A4V1RR23 | 11-137 | LPTDPVIGVPVPFAAGTEAGASVRTLDVRRVTQCALSRTCGVCGATLGRPLAFVGTPRELDRMAFHVPACHVDCAERLLASYADVAD… |
| A0A6I3L8F3 | 20-175 | None |
| A0A841BS30 | 15-188 | None |
| A0A1A2C5L5 | 2-163 | None |
| A0A1A1VWK7 | 2-177 | None |
| A0A0Q8UTI4 | 4-93 | None |
| A0A5C8NFZ7 | 2-107 | None |
| K0F127 | 12-117 | None |
| A0A2A3IM00 | 30-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.