DPCstruct | MC11692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 52 ± 4 aa |
| Standard deviation of domain lengths | 3.56 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1QNT8 | 37-86 | TLPYIYRWNRQDRKGQPCEVLARGTMNSCLVRFSDGYTMITSRNAIKKNK |
| A0A0Q4I8U2 | 8-59 | EILYDHIWRSRLSLKERAGHPLRILATGSMNMALVEFEDGVRHFVYRSAFRA |
| A0A249P967 | 2-55 | None |
| A0A0F9W8S4 | 86-138 | None |
| A0A6I0DXE7 | 5-55 | None |
| A0A3N5S5T9 | 2-50 | None |
| A0A542B348 | 43-90 | None |
| A0A1M5R1H2 | 48-97 | None |
| A0A1I6JL39 | 138-190 | None |
| A0A5S9NZ79 | 1-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.