DPCstruct | MC11691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 229 ± 35 aa |
| Standard deviation of domain lengths | 35.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P8IQC3 | 91-312 | EDNRTQFGIEHRVRNNRELPRIFLENLRYLQDFIAEQIPVLASNTVEGLRRCLHDRPLSYSDMTVRHGDEADILLTALAQGNLRADL… |
| A0A7K2L7V8 | 117-291 | AEEVIKARGWTYEWWTGPKDAQHYTNIKAIRGFCRPMHPVQQALIEPILVLCADTEQPIHAVEKSLTHEKMPQPMVRAVIQHLLWWG… |
| A0A1Z4I1J9 | 150-421 | None |
| A0A5J4KPX9 | 5-184 | None |
| A0A844MW70 | 81-341 | None |
| V6T5I2 | 148-398 | None |
| W4RSR7 | 98-348 | None |
| A0A4P7D1D1 | 174-414 | None |
| A0A6M5XX09 | 150-339 | None |
| A0A388RRM3 | 148-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.