DPCstruct | MC1169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9M7P7 | 1-134 | MGLVEHAERELRVAGFYDEDSDYSGMLAEAVMELIKLFAKQGHSGFSAGRTRQIFGKLADYQPLLPLTGDDDEWNECHDGMFQNNRC… |
| A0A520BK17 | 18-154 | PGNLLDHAGRELPKPEGDEMQALMNQQLREMVLVFSTHGHSGFSASWARHALGKLLAYEPIGPLTGEPDEWCEVSDGVYQNRRCSRV… |
| A0A348TS82 | 1-155 | None |
| A0A2W2DRV6 | 1-121 | None |
| A0A5Q2NXT9 | 2-142 | None |
| A0A5C7UCL2 | 62-188 | None |
| A0A6G7XHU8 | 1-114 | None |
| A0A127CH40 | 130-266 | None |
| A0A3S0BB98 | 68-201 | None |
| A0A0F9PZM5 | 3-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.