DPCstruct | MC11689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 214 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.25 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | PF14934- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8D2W4 | 182-388 | VNSFEFLQPLLRSLDYDMPKSSLSVQRALFLARVFWALYTMLYPWLNRKWLPHPFILPAEVYKVGVTHYFSFLKAKEELGYVPMVTP… |
| A0A0D3F9P1 | 1-215 | MAGKLRSPVNTFEFLSPLFQSLDYTVPRVRMDTSVALAISRFFVFMYTLLYPWLDSKWIPQPLLLPAEVYKVGVTHYFSYLKAREEI… |
| A0A565B3Y0 | 268-473 | None |
| A0A811PKU1 | 652-883 | None |
| A0A7I4AEW8 | 39-272 | None |
| A0A4S4E3A8 | 102-317 | None |
| A0A835P8I8 | 1-169 | None |
| A0A2D6BHX7 | 320-518 | None |
| A0A6M2EL77 | 1-237 | None |
| A0A835DWM9 | 990-1222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.