DPCstruct | MC11688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 71.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15704 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2EBG3 | 75-175 | YLLKLQEIRTRRGLTDELGAEAMMFEALEKVEKDIKKPLLRSDKKGMDLLVAEFEKGNKKLGIRKEDLPKYEENLELSMAKAQLDEL… |
| A0A0D3F091 | 1-104 | MGAEAMMMEALEKVEKEIKKPLLRSDKKNMGLLLAEFEKINKKLGIRKEDLPKIEEELELEIAKSELTELKKECVEAMEVQLKREEF… |
| A0A540M087 | 344-464 | None |
| A0A2R6XHT8 | 110-229 | None |
| A0A3P6CHY0 | 126-245 | None |
| A0A5B6W1X4 | 112-218 | None |
| A0A2G3CN76 | 167-287 | None |
| A0A4S4EX40 | 21-119 | None |
| A0A0D3C124 | 75-194 | None |
| A0A0D9YLU8 | 965-1085 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.