DPCstruct | MC11687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 56 ± 2 aa |
| Standard deviation of domain lengths | 2.28 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 67.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2KZM6 | 56-111 | KNGLGLQAVTKGSDYCQVTLNFPTDTVPKWKDPKTGQLEGLSFEFNLCEAVATWEQ |
| A0A444FQ70 | 94-149 | NGLGLQALVSQDYCQVTIQYPRDTVPKWRDPKTGELEGLSFDFNLCEAVATWEQVS |
| A0A453MXK6 | 79-135 | None |
| A0A0E0JUQ5 | 1-58 | None |
| A0A7J8LUX0 | 1-55 | None |
| A0A7N2MIG4 | 259-318 | None |
| A0A2G5CRF8 | 59-111 | None |
| A0A438K9N0 | 134-187 | None |
| A0A7J0H2K8 | 57-110 | None |
| M1BRC6 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.