DPCstruct | MC11683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T5HPX6 | 1-80 | MDFIYVEVLNDSNITKYISLLRKTSSKPINELKQAIETGKPVIECDYYDTEELKSLVIIIEQLLSLGASIKIYENDREIT |
| A0A1X1IGG5 | 1-108 | MLAIVIDSVGDKSGTYKLLRNHSSLPFSLIKSRIKDHDAVIEVYMLDLDGLRKVRELIHELNTIGTKVTIRDSTGIITLEIVNNLIS… |
| A0A173MFI2 | 4-124 | None |
| N0DYW0 | 10-126 | None |
| R6U8K7 | 6-104 | None |
| A0A518CMN9 | 2-113 | None |
| A0A286DWC5 | 21-141 | None |
| A0A1V5Q141 | 1-99 | None |
| A0A3M2LJQ1 | 11-107 | None |
| A0A6J4XNZ6 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.