DPCstruct | MC11682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 313 ± 36 aa |
| Standard deviation of domain lengths | 35.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T5C9V7 | 38-315 | LDTIQFKGERVVIPGNFPKELFHQTQEEFDVYYESISGKGNARTSGEVVLITYEELLPILVKHNAKYPLITSEEGILEKDLERVFRD… |
| A0A1E5SPN4 | 1-352 | MMRKTKTRILSLALLVALIFTYSCEDDIDTQSQVIYYKGLKVNHTYSVPADVITNANFSTIINEQTQSIINDAQIRTSNGQSVTYSL… |
| A0A2B4RA10 | 1-390 | None |
| A0A0U3KKG8 | 34-333 | None |
| A0A2Z4IE02 | 9-289 | None |
| A0A6G9ASV5 | 1-339 | None |
| A0A7X7HG89 | 91-385 | None |
| A0A7V5VZ18 | 1-262 | None |
| A0A1T4MEG6 | 290-588 | None |
| A0A7Y7DGY6 | 18-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.