DPCstruct | MC11681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 246 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7UGW4 | 1-260 | MLDKKFILPDPTQSKKETHKRMQILKKVIPKFVPATEAIMVSGSLAYGANYSVTEKSDIDLQLLVTRRGVTRLYTVGLFDLEKLRHF… |
| A0A022Y6B1 | 107-352 | LAVAQQLGFVFLAVGGSRAYHQKELTATGADHRDWDLIGVVKSKNDIVSLVLYSVAQLNALLGITKVENVKWQKALSEGRNEEWEVL… |
| A0A364MRF1 | 14-261 | None |
| A0A0G1LL59 | 1-253 | None |
| A0A4I7HAM6 | 10-243 | None |
| A0A505IJR7 | 3-239 | None |
| A0A6A6V2T1 | 13-255 | None |
| R6SUN9 | 4-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.