DPCstruct | MC11679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3NWF8 | 78-183 | MGAYHTIELELNRKFTLAKKSWDSVVLDRIEQACDATQKADVAAVVMQEGLANLVLVTPAMTLVRAKVEVTIPRKRRGSCTQHEKAL… |
| A0A813A2G7 | 1-95 | MGAFHTIELEMNRPFELHKQQWDSIYLERIETACNPERTAEVAAVIITPTSAQVCLVTPHMTLTRARLEGNVPSKYASTSTREKAVT… |
| A0A1E3NNS2 | 473-561 | None |
| A0A504Z3P2 | 36-141 | None |
| C4MA46 | 109-185 | None |
| A0A7R9KHP5 | 671-760 | None |
| A0A7E4W2Q3 | 54-156 | None |
| A0A812SEJ7 | 341-419 | None |
| A0A7J6SBS7 | 68-159 | None |
| A0A095B1D6 | 348-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.