DPCstruct | MC11677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 126 ± 22 aa |
| Standard deviation of domain lengths | 21.70 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.49 |
| Pfam Score | 81.45 |
| Assigned Pfam label(s) | CL0023- CL0220- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183WQU2 | 1-93 | LMFGDFMDVDSLPEDRVYEEIKDISEMYPVVERCLDDYNNANKKKMSLVIFRYVLEHLSRICRILRVPGGNALLVGVGGSGRQSLTR… |
| A0A430QJA3 | 291-419 | DRLVNDVDRDWFNQLINKTSKEMFNLNVNDYVTTTPLLYGDFLSISKNDASKYMEMTDHSKVLQVIEENLDDYNQINIAKMDLILFI… |
| A0A813PS57 | 87-191 | None |
| T1GEP1 | 27-127 | None |
| A0A821HPW7 | 10-126 | None |
| A0A7J6UIT8 | 281-403 | None |
| A0A812LF56 | 652-781 | None |
| A0A812IXU2 | 21-127 | None |
| A0A5J4TF66 | 170-304 | None |
| A0A3Q0JIY6 | 565-694 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.