DPCstruct | MC11673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 140 ± 25 aa |
| Standard deviation of domain lengths | 25.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17780 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1L952 | 53-171 | IKTLRKYIEQQQKKISKLKVKLCKKVETRNVAIQTNLDQDHQNAEKSVSEEITEAAEMAMQSTGFVYEETSGLYYDYNSGYYYNAEL… |
| A0A430Q860 | 2-151 | EFDVFEKLSELETEIHILKKELEEKDAFIQNLMDKNTDLERRLLSLDQNSVTGENNLSRVKEIAPNGSNTTDSKTYGASIANMLKET… |
| A0A5K4EI65 | 2-152 | None |
| F0WS22 | 239-366 | None |
| A0A7C9ANM9 | 16-147 | None |
| A0A6P4HV90 | 52-214 | None |
| A0A2P2KJ26 | 46-152 | None |
| A0A4U5QG05 | 46-133 | None |
| A0A1Y1I6B3 | 260-393 | None |
| A0A2H1BXW5 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.