DPCstruct | MC11672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 187 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05731 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9XG60 | 316-481 | EALEKKHREILDSVKEKAPRDLFSLKNLIHRLHISEPVQHVMSLLERRYPPDLPSFSRSRLPGPWDPTLAGTRMKLEVPQTWDRELS… |
| A0A430Q3H4 | 34-227 | LSIVTTEADYCALKVSGRGAGDASVDAVTDTLQSRIVDPSPIHFTLKELVRKLHISKPALNVMCVLGKLYPNDVTAFSKTGLEGDWD… |
| A0A3P7L4B1 | 244-418 | None |
| A0A7G2C7L3 | 213-407 | None |
| A0A3P7Y760 | 1-194 | None |
| A0A4E0RWY5 | 247-434 | None |
| A0A5K3FK64 | 18-194 | None |
| A0A6F9DJ15 | 1-185 | None |
| Q54CB5 | 222-409 | None |
| A0A5C6P162 | 311-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.