DPCstruct | MC11671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05019 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354VPF5 | 45-158 | TRILQMHDVWHLVAGYQTTSLHEIAISAFQLAQFGHNYSSMFLATVATMSCCKTPAGFGLLLQNITEAWRHGRATPALMPIHWESEW… |
| A0A430Q043 | 9-104 | DLVHALLGQPTDMLGEVVVKWVEGIQTLLPMCLTGGYFGSLRLAPKQTERFVESHLEYAIHTGREARFLMCVYFEEHWEDNLEDFRS… |
| T5ALT8 | 6-115 | None |
| A0A6V7U5F4 | 263-355 | None |
| D3AWR4 | 192-299 | None |
| G0R3W2 | 270-372 | None |
| A0A2U3E9H4 | 596-699 | None |
| A0A2P5CDE2 | 34-147 | None |
| A0A2T7NM28 | 1-94 | None |
| A0A2T0FDM2 | 126-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.