DPCstruct | MC11670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 781 |
|---|---|
| Mean domain length (aa) | 209 ± 39 aa |
| Standard deviation of domain lengths | 39.48 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.53 |
| Pfam Score | 92.59 |
| Assigned Pfam label(s) | PF02877- CL0649- CL0063- CL0492- CL0494 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430PYF7 | 122-312 | VHRHECPVLNLPIEFVHDSDDILVVNKPPSIPIHPCGQYTLNSITHILAKDYGLRPLRFTHRLDRMTSGLLLIAKNYDTSVRLQSQI… |
| A0A844M0U9 | 27-222 | MTQVTVYEDEDLLLVDKPAGLLSIDGKDLKVSLLSRLERANPEVKLIHRLDMDTSGLMIFAKNKQAQTHISKQFIERIPQKEYQAIV… |
| R5M3D8 | 187-407 | None |
| A0A821N3I2 | 73-264 | None |
| A0A6T7FKG3 | 1-132 | None |
| A0A7S2UG57 | 170-425 | None |
| A0A7C8DKA5 | 20-207 | None |
| A0A1Q9BZQ3 | 121-344 | None |
| A0A1Q9CBL1 | 13-206 | None |
| A0A3L7PDC7 | 371-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.