DPCstruct | MC1167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 438 |
|---|---|
| Mean domain length (aa) | 264 ± 53 aa |
| Standard deviation of domain lengths | 52.88 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.92 |
| Pfam Score | 87.44 |
| Assigned Pfam label(s) | CL0169- PF18976- PF11843 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H7I615 | 22-236 | DYRNKHEVVHKEVLLPANAPPEYSNRTKLWNAAECAEKRKNSQTARSINAALPRELSREDQIDLVRQFCEQCFVSKGMCCDFAIHDK… |
| A0A1H8SQI4 | 4-295 | FSLNHSFIGRSKHPPRAASFYARYISRPEACTQLTGERMPTERQELMAWLDEQEQGDRKNARVIDKVIVALPIELSHEDNAKLLHDF… |
| A0A0F3R6Z6 | 19-203 | None |
| A0A6S5Y8W9 | 1-264 | None |
| A0A1V5BP19 | 1-367 | None |
| L8LYG1 | 2-299 | None |
| A0A128EIF5 | 4-297 | None |
| A0A853DII0 | 49-301 | None |
| A0A3R6LKQ4 | 5-244 | None |
| A0A1W9JRK7 | 261-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.