DPCstruct | MC11669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 100 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4WXP9 | 2-90 | KTLTRTKLYEKIWTTPITRLSKEFGISDVGLAKTCTKYDIPRPPRGYWARIAAGYQDKQTPLPKADDVTIEFDVEANKRRRSAIKKQ… |
| A0A6I7QB40 | 1-111 | MKNITFNRTKLYNELWEKPMTQIAKDYKINVYQLTKVCDALEIPRPESGYWSKLRNGYEVKQKPLTEFKTNEYKHILCKEPEVDLKE… |
| A0A257V636 | 438-526 | None |
| A0A7V2ADN9 | 327-411 | None |
| A0A2N9LZG2 | 8-74 | None |
| A0A536W767 | 8-100 | None |
| A0A3S0BZC9 | 2-118 | None |
| A0A533BBK7 | 6-88 | None |
| A0A5C6UI37 | 3-144 | None |
| A0A7W3Q5K6 | 75-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.