DPCstruct | MC11665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 10.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01985 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9BQA7 | 79-141 | VYITLMRDVRIAFEGSELVRIGCRGFQPSDYKKIGAMLKELVPCVLLSFDDEQILMWRGREWK |
| A0A0K9PGV3 | 1-73 | MVRYAFLTDGIVCIDCKGLEKSDYRKIGYKLRNLVPCDLVTFEKEQVVVWKGKRKHDSNDELDENNNSSVEVE |
| U5CPJ4 | 556-625 | None |
| A0A2U1N000 | 984-1073 | None |
| A0A7J7NBF6 | 107-185 | None |
| A0A453ESG2 | 78-166 | None |
| A0A453ES77 | 79-166 | None |
| A0A4S4DR88 | 19-80 | None |
| A0A6D2HTQ5 | 7-70 | None |
| A0A0B0PE08 | 45-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.