DPCstruct | MC11664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 156 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256BN35 | 1-117 | MATWQCISSCGACCHLDPSERPDLADYLTAAELQQYLSMVGSDGWCINFDHLNRNCKIYDQRPRFCRVEPDTFYDMFGVEPEELDDF… |
| A0A6A2ZGP0 | 5-155 | VVLPSLGIVCSGRKPAQKEKKTAPKTKRSEVSMGFSGGRKEIWRCVENCGACCKLAKGPAFATPEEIFSDPCDIELYRSLIGPDGWC… |
| K9YZ57 | 152-279 | None |
| A0A4S4EVW5 | 15-171 | None |
| A0A5J4Z4L7 | 9-186 | None |
| A0A0D6AGS6 | 1-148 | None |
| W7TMW6 | 98-264 | None |
| D8LKL6 | 76-245 | None |
| A0A3S3NTC0 | 34-189 | None |
| L1IKU3 | 32-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.