DPCstruct | MC11662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 238 ± 40 aa |
| Standard deviation of domain lengths | 39.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.32 |
| Pfam Score | 97.02 |
| Assigned Pfam label(s) | CL0230- PF03759- PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287LAG3 | 21-256 | AMLLGYLDSFKEEQEFWYVWKDANEKEKGDAPRDGEKWWIPTVRVPPEGLSDQSRKWLQHQKDLVGQVLKAAMAINADVLGEMEIPE… |
| A0A6A2Z5X3 | 162-409 | ALAISNAIANLSGHDLQAPVGSLRQPPSFKKIGQHASPLQRHEEKWWLPVPQVPPGGLDENSRKELQHKRDCANQILKVAMAINNIT… |
| A0A445DD76 | 198-525 | None |
| A0A0A9NJ47 | 21-233 | None |
| A0A7J8MTW0 | 30-287 | None |
| A0A6A2XGX6 | 3-208 | None |
| A0A5P1ET14 | 243-502 | None |
| A0A835HCR6 | 3-184 | None |
| A0A1V5R1G6 | 89-311 | None |
| A0A446Q002 | 76-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.