DPCstruct | MC11661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 189 ± 35 aa |
| Standard deviation of domain lengths | 34.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3QNP0 | 29-222 | MHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQAVQEHIIEKYML… |
| A0A6A2Z5T4 | 7-215 | PNITCWVPQDMACDTFLKIVQKCKRKFVIVQVGENEPFVSELLSALAATVADLEPHHIHTFYESVGHMIQAEPDSFKRDEYLQRLMA… |
| A0A843W9J8 | 6-169 | None |
| A0A396GK11 | 8-200 | None |
| A0A7J7VWS2 | 138-331 | None |
| A0A3N7FA05 | 1-151 | None |
| A0A7S7LHW1 | 661-941 | None |
| A0A7J7P828 | 1-131 | None |
| A0A836DAZ6 | 330-502 | None |
| A0A0A9DER1 | 117-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.