DPCstruct | MC11660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 73 ± 3 aa |
| Standard deviation of domain lengths | 2.71 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 55.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2LD97 | 319-390 | AQVRELIASIVLSDPERYSEAFLGMPNERYCQCIQEPDRWGGGIEVAILSQVYEMEICLVDIQTGRIDRFGE |
| A0A4Y7IBW5 | 36-106 | TELRQVIVQKVASDPTKYTEAFLEVSNEEYCSWIQNSNTWGGAIELSILSEYYQKEIAAYHTDNVRCYVYG |
| A0A2A3EJA3 | 1096-1167 | None |
| A0A833Y9I5 | 33-110 | None |
| A0A812ZEQ6 | 115-186 | None |
| A0A2H5QWI8 | 2-70 | None |
| A0A2N9F938 | 33-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.