DPCstruct | MC1166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6FIG7 | 9-110 | IADTIRQQLLATTPMNVICSWGALHGFFATVHKGMATLMFKVNGRLFKGNVLISYNEMDYYEIYLKDANGIRLAHPEVYFDQLGDII… |
| A0A800EU93 | 14-121 | RSMEIANTIRSQIGRTLFMVGAKHLAAVKNGLKFRVGCRGTKANYITITLDGRDTYTFLAEKVTGGRFSHKTLTHSPVKTKTVLEME… |
| A0A482TWS2 | 16-108 | None |
| A0A1F3KUW1 | 5-103 | None |
| A0A4Q2UC37 | 4-102 | None |
| A0A2T5R4I8 | 26-129 | None |
| A0A229TFB5 | 35-122 | None |
| A0A7C7C5M6 | 1-110 | None |
| A0A496WKL0 | 3-113 | None |
| E0UN44 | 4-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.