DPCstruct | MC11659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 49.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C9UL13 | 779-842 | PAHTAVFPHPYQNKDTGDSSLGPGGDIRVYLEQLAEAPNVQEYVAQNPFGQQAITESDPSWDFY |
| A0A0K9PNN2 | 1162-1233 | HTAIFPYPYDYQNLVDNSLGPGGDLRVYLEGLAASDNVQEYVEKHPFGQKAITEKDPDWLYYKKIIDKINSE |
| A0A068UH95 | 33-92 | None |
| A0A2U1MU47 | 230-303 | None |
| A0A3L6QAR8 | 91-157 | None |
| A0A3L6T2C1 | 204-270 | None |
| A0A251VRY9 | 3-79 | None |
| A0A1S3YZZ7 | 90-165 | None |
| A0A2U1PPH6 | 39-111 | None |
| A0A830C776 | 107-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.