DPCstruct | MC11658
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14079 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8CLL1 | 8-123 | NALLIIEEVFLFIGSVLLFGLTTEYSWWMYVLLFFLPDISFAAYLINTKTGAFFYNLLHHKGLMVGLILLGYFTQLPLLLTIGIVFF… |
| A0A1I1U3L9 | 3-114 | TLLKSEEFIQFLGAIYLFSQLNFAWWWFPALLLVPDLSMIGYVINPAVGAVLYNLVHHKGLGVVIGLIGLMLGNQTLMLAGIILFAH… |
| A0A160F9P8 | 33-148 | None |
| A0A410NU40 | 41-159 | None |
| A0A2D2D0C5 | 21-144 | None |
| F6FUR4 | 16-147 | None |
| A0A2N9M0J3 | 19-136 | None |
| A0A2W4PAL3 | 15-128 | None |
| A0A257ZN16 | 3-98 | None |
| A0A246RMF2 | 5-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.