DPCstruct | MC11657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378VVD6 | 97-165 | MIFIDYGFDAAQYYHPQRNQGTLIGHYRHHVIHNPFDFIGLADLTAHVNFTDIAQAGTDAGLDLTGYLP |
| A0A1I1TW13 | 1-61 | MTIDYGFESADLYTPSRRQGTLRCYRNHTTNTSLYEQIGGQDITTSINFSALAHYTRVPNK |
| A0A846BEN0 | 70-130 | None |
| A0A4Q2XD09 | 11-72 | None |
| A0A1W1E3I5 | 12-65 | None |
| A0A354NXI9 | 52-112 | None |
| A0A836UGH0 | 32-91 | None |
| A0A2H5VRR8 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.