DPCstruct | MC11655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 509 |
|---|---|
| Mean domain length (aa) | 203 ± 45 aa |
| Standard deviation of domain lengths | 45.39 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 99.50 |
| Assigned Pfam label(s) | PF00238- CL0060- PF19540- CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L8CNY6 | 209-373 | AFVIALFTEMYGFPLTIYLLSGWLTSNFPNVDIFSHHAGHLWWVAFGGDTNPHSDPFHILSNILIFGGLALLYVAWRVLHKAQQLGQ… |
| A0A3L7DW93 | 32-232 | KVAWVINLHKIITLFIIYGMMLHFDNFSTAAWVYLGLHGIYGYCWLVKDFGFRDGSFETRVTYGGAVMTYLVLIAWYWLLPYLFLSR… |
| A0A538QLK6 | 27-218 | None |
| A0A1R3JRA8 | 33-253 | None |
| A0A438NJS5 | 32-323 | None |
| A0A810LJ54 | 155-300 | None |
| K3WFG2 | 294-549 | None |
| A0A833A4C3 | 100-272 | None |
| A0A1Q9CCJ6 | 291-554 | None |
| A0A166ARS2 | 318-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.