DPCstruct | MC11653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 10 aa |
| Standard deviation of domain lengths | 10.41 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5ZI74 | 39-194 | EAGAALTHNTVRLALAFYLAALLLMPRLGAAGWRAETLAGAAARQCWAWGAAAFVVHLAMAFHFYHHWSHAHAVAHTRQAAGWGEGV… |
| A0A832HQX7 | 23-169 | IFIAAWAIELAGRGQPDWERRARWGWTLGCLLFLAHFLAAFGGMYGWSLETLKEITAQQMDDFTGRRWGWPIWGKLMFAILWLADTL… |
| A0A6L8GDY4 | 2-142 | None |
| A0A1I3GK88 | 30-179 | None |
| A0A3D5K0B5 | 45-205 | None |
| A0A7Y4UBM0 | 2-127 | None |
| A0A3L7Q483 | 439-585 | None |
| A0A257U5R5 | 17-176 | None |
| A0A352L4Z2 | 37-183 | None |
| A0A2E3MQL7 | 2-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.