DPCstruct | MC11650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 192 ± 36 aa |
| Standard deviation of domain lengths | 35.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 23.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9T482 | 3-157 | ADCINVHDKSHHSLAFTQTPQFDKVIPQTFGYILRLYPFHPESKSFAPDGSPCTADTRGVLQRMHVTAMRARYIGKETDRKWEHGDD… |
| A0A2H9P2C0 | 4-172 | SNGIDANTGMQIRPIAPYIEPVRHAVFENCIDYNSGKKICGKQYWKTLTDEILEYMRNPESKLDGNEGILYRKNITVSQVTHIGKES… |
| A0A2V9CP55 | 13-250 | None |
| A0A2R6BKM9 | 103-291 | None |
| A0A525KBF6 | 370-593 | None |
| A0A2N5KGF8 | 34-232 | None |
| A0A840Q7E0 | 354-606 | None |
| A0A4Q3Y9G5 | 425-653 | None |
| A0A0E3LTZ5 | 376-550 | None |
| A0A2G9MYY1 | 178-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.