DPCstruct | MC1165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 4.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5AQ03 | 71-156 | YCGYMFKLFDVSADGVIDIAEYTDGMCSYGYKTDTAKQAFKHIAKDKKGERIEKIGPDDWNKLFHDYFFSKDKNALGNHLFGTINY |
| A0A800ET36 | 1-79 | MAEVLFHLFDTDQDGFISPFEFTSWLTAHGVSPTDAEKSFSAISKDGGSISRGRMLQLTSDFIRSDDPSKEGNMLFGPI |
| T2J4H3 | 1-74 | None |
| A0A846DFR2 | 10-83 | None |
| A0A1B0ATE7 | 345-427 | None |
| A0A6P0N9I1 | 58-136 | None |
| A0A226E219 | 227-313 | None |
| A0A1Z4J5D5 | 16-93 | None |
| A0A7R9A4M0 | 185-263 | None |
| A0A6P0P636 | 9-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.