DPCstruct | MC11648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4199 |
|---|---|
| Mean domain length (aa) | 184 ± 45 aa |
| Standard deviation of domain lengths | 45.12 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 20.69 |
| Pfam Score | 90.67 |
| Assigned Pfam label(s) | PF08352- CL0110- CL0177- CL0202- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A221BRP4 | 17-230 | VLKNINVQVKKGEVVVVVGPSGSGKSTLLRCINQLETITDGELIVQNTEVHNAKTDMNELRRNIGMVFQHFYLYPHKTVLQNITLAP… |
| A0A7I7ZYD5 | 16-177 | RPALDNVSLKIDKGEFVFLIGPSGSGKSTFMRLPAVRGADVAFALEVIGKRPDTCNRIVPDVLEMVGLSGKANRLPGELSGGEQQRV… |
| A0A538QC60 | 663-880 | None |
| A0A0D9XS69 | 27-178 | None |
| A0A5B7DHR4 | 175-309 | None |
| A0A6B0DV10 | 284-500 | None |
| A0A2G2QXL3 | 349-570 | None |
| A0A5N6ET59 | 14-228 | None |
| A0A2G4IXB4 | 69-231 | None |
| A0A6L7A871 | 8-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.