DPCstruct | MC11647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1771 |
|---|---|
| Mean domain length (aa) | 107 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.87 |
| Pfam Score | 97.61 |
| Assigned Pfam label(s) | CL0023- CL0301- PF09660- CL0063- CL0071 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836ZF32 | 1-88 | MTEAAFLVLVSVRQPITSEAIPAKIAEMTNNQLQLGLGTLFTNLHAMTKDYLMTERVDENDVHTYEITGSGESVLAAERKRLQLLNQI |
| A0A7I7ZV48 | 7-119 | LDALLRPYGITAPQYTALTVLQHSARLSAADLARHSFVTAQTMGEMVDTLQRLDLITRRADPNHKRRMLISLTDGGHRLLAECSKVV… |
| A0A6L3BWS8 | 15-93 | None |
| A0A2V2EZ94 | 47-177 | None |
| A0A6G6WZE8 | 8-116 | None |
| A0A2N2GQ29 | 22-109 | None |
| A0A7X3SKM9 | 232-309 | None |
| A0A136I0K8 | 66-181 | None |
| A0A640S635 | 1-109 | None |
| A0A1C2I688 | 4-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.