DPCstruct | MC11646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 200 ± 25 aa |
| Standard deviation of domain lengths | 25.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E7A1E4 | 2-161 | SAELHATSAHGNTYRIYVDLDAGARLDAVYGSSANPLVLGGNGLYHTPMWGVDMASTLNADLIAVFTSLAYDSWVTIGLDNMTGNVL… |
| A0A3D6DGS2 | 11-249 | AGAQTPLGLPINPQQSNTTTLPSSAQYYLEIDTVNHNVGTLLTTDLEGFSTYRVYVVTEASSDQVSAVYGNIDEPSELISSGDIFQS… |
| A0A7C7NJD8 | 415-611 | None |
| A0A2E8KR87 | 2-148 | None |
| A0A2D5YTB4 | 11-223 | None |
| A0A2D5AE92 | 7-299 | None |
| A0A2D5AEC1 | 33-251 | None |
| A0A2D5E0A7 | 25-224 | None |
| A0A2E8RBZ7 | 77-262 | None |
| A0A2D5QDZ6 | 210-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.