DPCstruct | MC11643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843G3C8 | 19-92 | RKEKLSDLPNGATEYVLDDIEKVLQRLMECGFNCVAGVDFTRPEIGIPVVRMVVPGLEVWTMDHEREGNRLYGR |
| A0A843CQK1 | 84-173 | MGYDKIKQVNRLWYSDGPKKIALEEMEDKSTPYVLDDIEVVLGRLMDCGFDMVAAVDLTRPELGIPTVRMVVPGLEVSTMDPEREGG… |
| A0A847Y6R8 | 3-91 | None |
| A0A0D0PRY5 | 9-82 | None |
| A0A7C4B7G0 | 5-103 | None |
| A0A843FZ30 | 21-119 | None |
| A0A843ET54 | 1-73 | None |
| A0A5E4KEK9 | 1-68 | None |
| A0A7K4D835 | 81-153 | None |
| A0A7J4MUZ1 | 56-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.