DPCstruct | MC11642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7C4K5 | 24-105 | REACINIADSDEPLLFIEGHDNAIIGVTERGGVALIVYDSEKILRRLRKRDGMSKDDAEEFFAYNIYGAWRGEQTPIFVAKI |
| A0A843FPD0 | 4-82 | EELLDWCEEGTVILEGEEYDQAIVGISTDGKLVYDYDELVNVLMEDMTPEEAMDYLDYNTLRAIPYMGDKAPIIMRRID |
| A0A2D7XCR0 | 24-113 | None |
| A0A2D6X005 | 24-125 | None |
| A0A2D6HZ51 | 3-101 | None |
| A0A2D7X1K9 | 1-78 | None |
| A0A2D7WW23 | 5-78 | None |
| A0A3D2RUM7 | 1-72 | None |
| A0A497P2E0 | 3-86 | None |
| A0A7C8D4P2 | 14-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.